PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00009.1.g07040.1.es.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 216aa    MW: 25596.3 Da    PI: 7.553
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00009.1.g07040.1.es.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2017.3e-622209165374
                            GRAS 165 LakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvve 243
                                     L+++A++++vpfef++ +a+r e++++e+L+++++E l+Vn+ ++ ++l+desv  es+r+ vL+++++++P+++++  
  Zjn_sc00009.1.g07040.1.es.mkhc   2 LKDYAQTFNVPFEFQA-IASRYEAVQIEDLHIEKDELLIVNCLFRFETLMDESVVAESPRNMVLNTIRKMNPHLFIHGI 79 
                                     899*************.7************************************************************* PP

                            GRAS 244 qeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleea 322
                                      + ++n++ F+ rf eal+ ysa+fd+l++++pr++e+r  +E +l+gre+ nv++ceg er+er e +++W+ r ++a
  Zjn_sc00009.1.g07040.1.es.mkhc  80 VNGSYNAPFFMSRFREALYQYSAIFDMLDTNIPRDNEQRLLIESALFGREAINVISCEGLERQERPEIYKQWQVRNQRA 158
                                     ******************************************************************************* PP

                            GRAS 323 GFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                     GFk++p+++ ++k  +  +r +++d + ++e++ +l+lgWk+r ++++S W+
  Zjn_sc00009.1.g07040.1.es.mkhc 159 GFKQLPVNQGIMKRSREKVRCYHKD-FVIDEDNRWLLLGWKGRIILALSTWK 209
                                     ***********************77.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098533.4581190IPR005202Transcription factor GRAS
PfamPF035142.5E-592209IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
YLKDYAQTFN VPFEFQAIAS RYEAVQIEDL HIEKDELLIV NCLFRFETLM DESVVAESPR  60
NMVLNTIRKM NPHLFIHGIV NGSYNAPFFM SRFREALYQY SAIFDMLDTN IPRDNEQRLL  120
IESALFGREA INVISCEGLE RQERPEIYKQ WQVRNQRAGF KQLPVNQGIM KRSREKVRCY  180
HKDFVIDEDN RWLLLGWKGR IILALSTWKP DHRSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-172209167375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456620.11e-142hypothetical protein SORBIDRAFT_03g039510
SwissprotO809332e-92SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0A9DR931e-149A0A0A9DR93_ARUDO; Uncharacterized protein
TrEMBLC5XPP91e-142C5XPP9_SORBI; Putative uncharacterized protein Sb03g039510
STRINGSb03g039510.11e-142(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2228967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-93GRAS family protein